CABIN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CABIN1 Polyclonal antibody, PBS Only (31409-1-PBS)

• 

  WB analysis using 31409-1-AP (same clone as 31409-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31409-1-AP (CABIN1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31409-1-PBS in a different storage buffer formulation.

CABIN1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31409-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31409-1-PBS targets CABIN1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35666

  Product name: Recombinant human CABIN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1985-2220 aa of NM_001199281.1

  Sequence: ASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKMAPTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAASSKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSPKGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI

• Full Name: calcineurin binding protein 1
• Calculated Molecular Weight: 246kDa，2220aa
• Observed Molecular Weight: 260 kDa
• GenBank Accession Number: NM_001199281.1
• Gene Symbol: CABIN1
• Gene ID (NCBI): 23523
• RRID: AB_3669969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y6J0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.