CABLES1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CABLES1 Polyclonal antibody, PBS Only (13464-1-PBS)

• 

  WB analysis using 13464-1-AP (same clone as 13464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13464-1-AP (CABLES1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13464-1-AP (same clone as 13464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13464-1-AP (CABLES1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 13464-1-AP (same clone as 13464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 13464-1-AP (CABLES1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13464-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 13464-1-AP (same clone as 13464-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CABLES1 antibody (13464-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 13464-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13464-1-AP (same clone as 13464-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CABLES1 antibody (13464-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 13464-1-PBS in a different storage buffer formulation.

CABLES1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13464-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Ik3-1, HsT2563, CABLES

---

Product Information

13464-1-PBS targets CABLES1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4251

  Product name: Recombinant human CABLES1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-368 aa of BC037218

  Sequence: SQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS

• Full Name: Cdk5 and Abl enzyme substrate 1
• Calculated Molecular Weight: 568 aa, 63 kDa
• Observed Molecular Weight: 68 kDa, 42 kDa
• GenBank Accession Number: BC037218
• Gene Symbol: CABLES1
• Gene ID (NCBI): 91768
• RRID: AB_3669163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDN4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDK5 and ABL1 enzyme substrate 1 (CABLES1) is a novel Cdk2, Cdk3, and Cdk5 binding protein, which acts as a link between the Cdks and nonreceptor tyrosine kinases and regulates the activity of Cdks by enhancing their Y15 phosphorylation. CABLES1 is a candidate tumor suppressor that negatively regulates cell growth by inhibiting cyclin-dependent kinases.