CABP4 Polyclonal antibody

• 

  WB analysis using 32176-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32176-1-AP (CABP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CABP4 Polyclonal Antibody for WB, ELISA

Cat No. 32176-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Calcium-binding protein 4

---

Tested Applications

• Positive WB detected in: rat retina tissue, mouse retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32176-1-AP targets CABP4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37335

  Product name: Recombinant human CABP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of NM_145200.3

  Sequence: MTTEQARGQQGPNLAIGRQKPPAGVVTPKSDAEEPPLTRKRSKKERGLRGSRKRTGSSGEQTGPEAPGSSNNPPSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKDRELGPEELDELQAAFEEFDTDRDGYIS

• Full Name: calcium binding protein 4
• Calculated Molecular Weight: 30kDa，275aa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_145200.3
• Gene Symbol: CABP4
• Gene ID (NCBI): 57010
• RRID: AB_3670214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P57796
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CABP4, a member of the calcium-binding protein (CABP) family, is located in photoreceptor synaptic terminals and is directly associated with the C-terminal domain of the Cav1.4α. Mice lacking either Cabp4 or Cav1.4α display a CSNB2-like phenotype. Mutations in CABP4 lead to autosomal recessive congenital stationary night blindness (CSNB) (PMID: 16960802).