CABP7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CABP7 Polyclonal antibody, PBS Only (17675-1-PBS)

• 

  WB analysis using 17675-1-AP (same clone as 17675-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17675-1-AP (CABP7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17675-1-AP (same clone as 17675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17675-1-AP (CABP7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17675-1-AP (same clone as 17675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17675-1-AP (CABP7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17675-1-PBS in a different storage buffer formulation.

CABP7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17675-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Calcium-binding protein 7, CALN2, Calneuron II, Calneuron-2

---

Product Information

17675-1-PBS targets CABP7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11654

  Product name: Recombinant human CABP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC051805

  Sequence: MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKSL

• Full Name: calcium binding protein 7
• Calculated Molecular Weight: 215 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC051805
• Gene Symbol: CABP7
• Gene ID (NCBI): 164633
• RRID: AB_3085533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86V35
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CABP7 belongs to the calmodulin superfamily of proteins and harbors 2 high-affinity EF-hand motifs and a C-terminal transmembrane domain. CABP7 controls cytokinesis by modulating phosphatidylinositol 4-phosphate (PI4P) levels in cells.