CABYR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CABYR Polyclonal antibody (12351-1-AP)

• Featured Product
• KD/KO Validated

CABYR Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12351-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

CABYR, Calcium binding protein 86, Cancer/testis antigen 88, CBP86, CT88, Fibrousheathin 2, Fibrousheathin II, FSP 2, FSP2

• 

  WB analysis of human testis using 12351-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 12351-1-AP (CABYR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 12351-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12351-1-AP (CABYR antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 12351-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 12351-1-AP (CABYR Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 12351-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 12351-1-AP (CABYR Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12351-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12351-1-AP (CABYR antibody) at dilution of 1:50 (under 25x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12351-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12351-1-AP (CABYR antibody) at dilution of 1:50 (under 25x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CABYR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue
• Positive IHC detected in: human testis tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12351-1-AP targets CABYR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3012

  Product name: Recombinant human CABYR protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 3-379 aa of BC011996

  Sequence: SSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN

• Full Name: calcium binding tyrosine-(Y)-phosphorylation regulated
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa, 86-90 kDa
• GenBank Accession Number: BC011996
• Gene Symbol: CABYR
• Gene ID (NCBI): 26256
• RRID: AB_2069257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75952
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

CABYR Polyclonal Antibody (Cat# 12351-1-AP) has 6 citations published in Nature Communications, Journal of Genetics and Genomics, Journal of Cell Science, Animals (Basel), and Clinical Genetics. The associated research fields include sperm flagella structure and function, fibrous sheath assembly, acrosome biogenesis, male infertility, and comparative sperm proteomics across species.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Loss-of-function mutations in QRICH2 cause male infertility with multiple morphological abnormalities of the sperm flagella.; Authors - Ying Shen
mouse	WB,IF	J Genet Genomics; Coiled-coil domain-containing 38 is required for acrosome biogenesis and fibrous sheath assembly in mice; Authors - Yaling Wang
MOUSE	WB	J Cell Sci; CABYR is essential for fibrous sheath integrity and progressive motility in mouse spermatozoa.; Authors - Samantha A M Young ; KO Validated
mouse	IF	J Cell Sci; Radial spoke head 6 homolog A is required for sperm flagellum formation and male fertility in mice.; Authors - Ferheen Abbasi
	WB	Animals (Basel); Comparative Study on the Sperm Proteomes of Horses and Donkeys; Authors - Hong Ren
human,mouse	IF	Clin Genet; Biallelic mutations in PMFBP1 cause acephalic spermatozoa.; Authors - Yan-Wei Sha