CACNA1B Polyclonal antibody

• 

  WB analysis using 30625-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30625-1-AP (CACNA1B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse cerebellum using 30625-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using CACNA1B antibody (30625-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CACNA1B Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 30625-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, ELISA

Synonyms

BIII, CACH5, CACNL1A5, CACNN, Calcium channel, L type, alpha-1 polypeptide isoform 5

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, Y79 cells
• Positive IF-P detected in: mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30625-1-AP targets CACNA1B in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33516

  Product name: Recombinant human CACNA1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1841-1995 aa of NM_000718

  Sequence: VPPHKPDEMTVGKVYAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLES

• Full Name: calcium channel, voltage-dependent, N type, alpha 1B subunit
• Calculated Molecular Weight: 262 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: NM_000718
• Gene Symbol: CACNA1B
• Gene ID (NCBI): 774
• RRID: AB_3669741
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00975
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CACNA1B, also named CACH5, CACNL1A5, and BIII, belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division, and cell death. CACNA1B gives rise to N-type calcium currents. N-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by omega-conotoxin-GVIA (omega-CTx-GVIA) and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to dihydropyridines (DHP), and omega-agatoxin-IVA (omega-Aga-IVA). CACNA1B may play a role in the directed migration of immature neurons.