CACNA2D4 Polyclonal antibody

• 

  WB analysis using 26674-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26674-1-AP (CACNA2D4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 26674-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26674-1-AP (CACNA2D4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26674-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26674-1-AP (CACNA2D4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CACNA2D4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26674-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

RCD4, Voltage-dependent calcium channel subunit alpha-2/delta-4, Voltage-dependent calcium channel subunit alpha-2-4, Voltage-dependent calcium channel subunit delta-4, Voltage-gated calcium channel subunit alpha-2/delta-4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26674-1-AP targets CACNA2D4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24464

  Product name: Recombinant human CACNA2D4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 532-601 aa of BC150186

  Sequence: GSDVALRELMKLAPRYKMPSTNSRPNAPPPWTLAAWSARIRLSEHQQWLHPLPSRPPAPVQRGEETKTQT

• Full Name: calcium channel, voltage-dependent, alpha 2/delta subunit 4
• Calculated Molecular Weight: 1137 aa, 128 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC150186
• Gene Symbol: CACNA2D4
• Gene ID (NCBI): 93589
• RRID: AB_3669562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z3S7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calcium voltage-gated channel auxiliary subunit alpha2delta 4 (CACNA2D4, also known as RCD4) is a member of the alpha-2/delta subunit family within the voltage-dependent calcium channel complex. The α2δ4 subunit of retinal voltage-gated calcium channels (Cav), is crucial for developing and mature exocytotic function of the photoreceptor ribbon synapse (PMID: 29875267). CACNA2D4 is localized to the retina, particularly in photoreceptors, where it is essential for organizing synaptic ribbons and setting Cav1.4 voltage sensitivity (PMID: 28262416). In humans, mutations in CACNA2D4 are associated with autosomal recessive cone dystrophy, a condition that affects the photoreceptor cells in the retina (PMID: 16877424).