CACNA2D4 Polyclonal antibody

CACNA2D4 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26674-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

RCD4, Voltage-dependent calcium channel subunit alpha-2/delta-4, Voltage-dependent calcium channel subunit alpha-2-4, Voltage-dependent calcium channel subunit delta-4, Voltage-gated calcium channel subunit alpha-2/delta-4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26674-1-AP targets CACNA2D4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24464

Product name: Recombinant human CACNA2D4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 532-601 aa of BC150186

Sequence: GSDVALRELMKLAPRYKMPSTNSRPNAPPPWTLAAWSARIRLSEHQQWLHPLPSRPPAPVQRGEETKTQT

Predict reactive species
Full Name calcium channel, voltage-dependent, alpha 2/delta subunit 4
Calculated Molecular Weight 1137 aa, 128 kDa
Observed Molecular Weight100 kDa
GenBank Accession NumberBC150186
Gene Symbol CACNA2D4
Gene ID (NCBI) 93589
RRIDAB_3669562
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7Z3S7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calcium voltage-gated channel auxiliary subunit alpha2delta 4 (CACNA2D4, also known as RCD4) is a member of the alpha-2/delta subunit family within the voltage-dependent calcium channel complex. The α2δ4 subunit of retinal voltage-gated calcium channels (Cav), is crucial for developing and mature exocytotic function of the photoreceptor ribbon synapse (PMID: 29875267). CACNA2D4 is localized to the retina, particularly in photoreceptors, where it is essential for organizing synaptic ribbons and setting Cav1.4 voltage sensitivity (PMID: 28262416). In humans, mutations in CACNA2D4 are associated with autosomal recessive cone dystrophy, a condition that affects the photoreceptor cells in the retina (PMID: 16877424).

Protocols

Product Specific Protocols
IHC protocol for CACNA2D4 antibody 26674-1-APDownload protocol
WB protocol for CACNA2D4 antibody 26674-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...