CACNA2D4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CACNA2D4 Polyclonal antibody, PBS Only (26674-1-PBS)

• 

  WB analysis using 26674-1-AP (same clone as 26674-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26674-1-AP (CACNA2D4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26674-1-AP (same clone as 26674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26674-1-AP (CACNA2D4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26674-1-AP (same clone as 26674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26674-1-AP (CACNA2D4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26674-1-PBS in a different storage buffer formulation.

CACNA2D4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26674-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

RCD4, Voltage-dependent calcium channel subunit alpha-2/delta-4, Voltage-dependent calcium channel subunit alpha-2-4, Voltage-dependent calcium channel subunit delta-4, Voltage-gated calcium channel subunit alpha-2/delta-4

---

Product Information

26674-1-PBS targets CACNA2D4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24464

  Product name: Recombinant human CACNA2D4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 532-601 aa of BC150186

  Sequence: GSDVALRELMKLAPRYKMPSTNSRPNAPPPWTLAAWSARIRLSEHQQWLHPLPSRPPAPVQRGEETKTQT

• Full Name: calcium channel, voltage-dependent, alpha 2/delta subunit 4
• Calculated Molecular Weight: 1137 aa, 128 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC150186
• Gene Symbol: CACNA2D4
• Gene ID (NCBI): 93589
• RRID: AB_3669562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z3S7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calcium voltage-gated channel auxiliary subunit alpha2delta 4 (CACNA2D4, also known as RCD4) is a member of the alpha-2/delta subunit family within the voltage-dependent calcium channel complex. The α2δ4 subunit of retinal voltage-gated calcium channels (Cav), is crucial for developing and mature exocytotic function of the photoreceptor ribbon synapse (PMID: 29875267). CACNA2D4 is localized to the retina, particularly in photoreceptors, where it is essential for organizing synaptic ribbons and setting Cav1.4 voltage sensitivity (PMID: 28262416). In humans, mutations in CACNA2D4 are associated with autosomal recessive cone dystrophy, a condition that affects the photoreceptor cells in the retina (PMID: 16877424).