CACNG5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CACNG5 Polyclonal antibody (18498-1-AP)

CACNG5 Polyclonal Antibody for WB, ELISA

Cat No. 18498-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CACNG5

• 

  WB analysis of SH-SY5Y using 18498-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 18498-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 18498-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CACNG5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18498-1-AP targets CACNG5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13339

  Product name: Recombinant human CACNG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC101607

  Sequence: MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC

• Full Name: calcium channel, voltage-dependent, gamma subunit 5
• Calculated Molecular Weight: 275 aa, 31 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC101607
• Gene Symbol: CACNG5
• Gene ID (NCBI): 27091
• RRID: AB_10667007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UF02
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CACNG5 Polyclonal antibody (Cat# 18498-1-AP) has 1 total citation. It appears in Cell Reports (2026), in a study titled "LKB1 inactivation elicits an NNMT-mediated methyl sink and confers dependence on PRMT5 in lung cancer." The research field is lung cancer biology, specifically involving epigenetic regulation through methylation pathways and PRMT5 dependence. The antibody was used in Western Blot for human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; LKB1 inactivation elicits an NNMT-mediated methyl sink and confers dependence on PRMT5 in lung cancer; Authors - Wen Mi