CACNG5 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 18498-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 18498-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 18498-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

CACNG5 Polyclonal Antibody for WB, ELISA

Cat No. 18498-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CACNG5

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18498-1-AP targets CACNG5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13339

  Product name: Recombinant human CACNG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC101607

  Sequence: MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC

• Full Name: calcium channel, voltage-dependent, gamma subunit 5
• Calculated Molecular Weight: 275 aa, 31 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC101607
• Gene Symbol: CACNG5
• Gene ID (NCBI): 27091
• RRID: AB_10667007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UF02
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.