CADM2 Polyclonal antibody

CADM2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17773-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Cell adhesion molecule 2, IgSF4D, Necl 3, NECL3, NECL-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17773-1-AP targets CADM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12191

Product name: Recombinant human CADM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-337 aa of BC105999

Sequence: VKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPDHA

Predict reactive species
Full Name cell adhesion molecule 2
Calculated Molecular Weight 404 aa, 44 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC105999
Gene Symbol CADM2
Gene ID (NCBI) 253559
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N3J6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CADM2, also known as IGSF4D, NECL3, SYNCAM2, is a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. CADM2 is a conserved modular organization comprising three Ig domains, a single transmembrane pass and a short cytoplasmic region containing 4.1 and PDZ binding motifs. CADM2 is a plasma membrane protein that accumulates in several tissues, including those of the central and peripheral nervous system, where it localizes to myelinated axons and in ependymal cells (PMID: 16311015, 17967169). The molecular weight of the CADM2 protein is approximately 50-60 kDa, which is due to N-linked glycosylation (PMID: 17967169, 21456004).

Protocols

Product Specific Protocols
IHC protocol for CADM2 antibody 17773-1-APDownload protocol
WB protocol for CADM2 antibody 17773-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...