CADM2 Polyclonal antibody

• 

  WB analysis using 17773-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17773-1-AP (CADM2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17773-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17773-1-AP (CADM2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 17773-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17773-1-AP (CADM2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17773-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17773-1-AP (CADM2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CADM2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17773-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Cell adhesion molecule 2, IgSF4D, Necl 3, NECL3, NECL-3

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17773-1-AP targets CADM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12191

  Product name: Recombinant human CADM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-337 aa of BC105999

  Sequence: VKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPDHA

• Full Name: cell adhesion molecule 2
• Calculated Molecular Weight: 404 aa, 44 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC105999
• Gene Symbol: CADM2
• Gene ID (NCBI): 253559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3J6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CADM2, also known as IGSF4D, NECL3, SYNCAM2, is a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. CADM2 is a conserved modular organization comprising three Ig domains, a single transmembrane pass and a short cytoplasmic region containing 4.1 and PDZ binding motifs. CADM2 is a plasma membrane protein that accumulates in several tissues, including those of the central and peripheral nervous system, where it localizes to myelinated axons and in ependymal cells (PMID: 16311015, 17967169). The molecular weight of the CADM2 protein is approximately 50-60 kDa, which is due to N-linked glycosylation (PMID: 17967169, 21456004).