CAPS1 Polyclonal antibody

• 

  WB analysis of rat brain using 11490-2-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 11490-2-AP (CAPS1 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 11490-2-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11490-2-AP (CAPS1 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas using 11490-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 11490-2-AP (CAPS1 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human pancreas using 11490-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 11490-2-AP (CAPS1 antibody at dilution of 1:200 (under 40x lens).

• 

  IF Staining of SH-SY5Y using 11490-2-AP

  Immunofluorescent analysis of (-20℃ Acetone) fixed SH-SY5Y cells using 11490-2-AP (CAPS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

CAPS1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11490-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CADPS, CADPS1, Calcium dependent secretion activator 1, Calcium-dependent activator protein for secretion 1, Calcium-dependent secretion activator 1

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse brain tissue
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11490-2-AP targets CAPS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1975

  Product name: Recombinant human CADPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC015754

  Sequence: MFNVMVDAKAQSTKLCSMEMGQEFAKMWHQYHSKIDELIEETVKEMITLLVAKFVTILEGVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVADAYVTFVRHSQDVLRDKVNEEMYIERLFDQWYNSSMNVICTWLTDRMDLQLHIYQLKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATASVSEGGGLQGISMKDSDEEDEEDD

• Full Name: Ca++-dependent secretion activator
• Calculated Molecular Weight: 1353 aa, 153 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC015754
• Gene Symbol: CAPS1
• Gene ID (NCBI): 8618
• RRID: AB_2068173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULU8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.