NDP52 Polyclonal antibody

• 

  WB analysis using 12229-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 12229-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 12229-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12229-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 12229-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12229-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 12229-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12229-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 12229-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12229-1-AP (NDP52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 12229-1-AP

  IP result of anti-NDP52 (IP:12229-1-AP, 3ug; Detection:12229-1-AP 1:1000) with HeLa cells lysate 2150ug.

• 

  IHC staining of human ovary cancer using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 12229-1-AP (NDP52 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 12229-1-AP (NDP52 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skeletal muscle using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 12229-1-AP (NDP52 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 12229-1-AP (NDP52 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary tumor using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 12229-1-AP (NDP52 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary tumor using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 12229-1-AP (NDP52 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary tumor using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12229-1-AP (NDP52 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 12229-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12229-1-AP (NDP52 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 12229-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using NDP52 antibody (12229-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

NDP52 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12229-1-AP

Publications(62)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CALCOCO2, Calcium-binding and coiled-coil domain-containing protein 2, Nuclear domain 10 protein 52, Nuclear dot protein 52

---

Tested Applications

• Positive WB detected in: HeLa cells, human placenta tissue, Jurkat cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, A549 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human ovary cancer tissue, human ovary tumor tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 8 publications below
• WB: See 54 publications below
• IHC: See 1 publications below
• IF: See 7 publications below
• IP: See 5 publications below
• CoIP: See 2 publications below

Product Information

12229-1-AP targets NDP52 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2866

  Product name: Recombinant human CALCOCO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-283 aa of BC015893

  Sequence: MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLE

• Full Name: calcium binding and coiled-coil domain 2
• Calculated Molecular Weight: 446 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC015893
• Gene Symbol: NDP52
• Gene ID (NCBI): 10241
• RRID: AB_11182600
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13137
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDP52, also named as CALCOCO2, is an autophagy receptor. It plays a role in ruffle formation and actin cytoskeleton organization. Mouse/Rat NDP52 has some isoforms with MW 28-40 kDa and 67 kDa. Human NDP52 has some isoforms with MW 43-47 kDa and 52-55 kDa,

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell; NF-κB Restricts Inflammasome Activation via Elimination of Damaged Mitochondria.; Authors - Zhenyu Zhong
human	WB	Mol Cell; PMID: 28965816; Authors - Shouheng Jin ; KO Validated
human	WB	Autophagy; TOLLIP-mediated autophagic degradation pathway links the VCP-TMEM63A-DERL1 signaling axis to triple-negative breast cancer progression; Authors - Tai-Mei Zhang
		Autophagy; ATG4B antagonizes antiviral immunity by GABARAP-directed autophagic degradation of TBK1; Authors - Weihong Xie
human	WB	Nat Commun; TDP-43 and PINK1 mediate CHCHD10S59L mutation-induced defects in Drosophila and in vitro.; Authors - Minwoo Baek
mouse	WB	Nat Commun; Microglia clear neuron-released α-synuclein via selective autophagy and prevent neurodegeneration.; Authors - Insup Choi