Tested Applications
| Positive WB detected in | MCF-7 cells, PC-12 cells, mouse brain tissue, mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20868-1-AP targets CALCR in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14920 Product name: Recombinant human CALCR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-164 aa of BC075028 Sequence: AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLV Predict reactive species |
| Full Name | calcitonin receptor |
| Calculated Molecular Weight | 490 aa, 57 kDa |
| Observed Molecular Weight | 57 kDa, 70 kDa |
| GenBank Accession Number | BC075028 |
| Gene Symbol | CALCR |
| Gene ID (NCBI) | 799 |
| RRID | AB_2878754 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30988 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The CALCR protein, also known as the calcitonin receptor, is a high-affinity receptor for the peptide hormone calcitonin and belongs to the subfamily of seven transmembrane-spanning G protein-coupled receptors. This protein plays a critical role in maintaining calcium homeostasis and regulating osteoclast-mediated bone resorption. The calcitonin receptor is involved in several physiological processes, including inhibition of osteoclastic bone resorption and increased renal calcium excretion, which helps to regulate Ca2+ concentrations. In addition, the CALCR protein has been detected in a variety of tissues not directly involved in the regulation of calcium homeostasis, with particular expression observed in the brain, suggesting distinct functions in the central nervous system (CNS) (PMID: 12730726). As determined by our laboratory, the molecular weight of the full-length protein is 57 kDa, while that of the fully mature protein is 70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CALCR antibody 20868-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CALCR Polyclonal antibody (Cat# 20868-1-AP) has 7 citations across journals including Cell Metabolism, Nature Communications, Advanced Science, Molecular Medicine, Journal of Cellular and Molecular Medicine, Current Issues in Molecular Biology, and Biomaterials & Biosystems. Research fields span bone mechanobiology and osteoclastogenesis, osteocyte calcium dynamics in diabetes, cancer drug resistance, fibrous dysplasia, and platinum resistance in ovarian cancer. All citations used the antibody for Western blot in human and/or mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Metab Gut microbial alterations in arginine metabolism determine bone mechanical adaptation | ||
Nat Commun Rescuing SERCA2 pump deficiency improves bone mechano-responsiveness in type 2 diabetes by shaping osteocyte calcium dynamics | ||
Adv Sci (Weinh) Enhanced Protein Damage Clearance Induces Broad Drug Resistance in Multitype of Cancers Revealed by an Evolution Drug-Resistant Model and Genome-Wide siRNA Screening. | ||
Mol Med A CREB1-miR-181a-5p loop regulates the pathophysiologic features of bone marrow stromal cells in fibrous dysplasia of bone. | ||
J Cell Mol Med Cytisine attenuates bone loss of ovariectomy mouse by preventing RANKL-induced osteoclastogenesis. | ||
Curr Issues Mol Biol COPS5 Conferred the Platinum Resistance in Epithelial Ovarian Cancer |
Reviews
What customers say
The single review for 20868-1-AP reports a Western Blot on T cells using a 1:1000 dilution. The user detected two bands at approximately 70 and 85 kDa, and rated the product 3 out of 5. Overall, the feedback indicates the antibody produced visible bands at the expected molecular weights under the tested conditions, though the moderate rating suggests the result may not have fully met expectations.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wojciech (Verified Customer) (04-17-2026) | Two bands were detected at ~70 and ~85 kDa. The dilution used: 1:1000.
|
