CALML3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CALML3 Polyclonal antibody, PBS Only (17275-1-PBS)

• 

  WB analysis using 17275-1-AP (same clone as 17275-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 17275-1-AP (CALML3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17275-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A431 using 17275-1-AP (same clone as 17275-1-PBS)

  IP result of anti-CALML3 (IP:17275-1-AP, 4ug; Detection:17275-1-AP 1:300) with A431 cells lysate 2400 ug. This data was developed using the same antibody clone with 17275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17275-1-AP (same clone as 17275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17275-1-AP (CALML3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17275-1-AP (same clone as 17275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17275-1-AP (CALML3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17275-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 17275-1-AP (same clone as 17275-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CALML3 antibody (17275-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17275-1-PBS in a different storage buffer formulation.

CALML3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 17275-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

17275-1-PBS targets CALML3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11037

  Product name: Recombinant human CALML3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-149 aa of BC031889

  Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

• Full Name: calmodulin-like 3
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC031889
• Gene Symbol: CALML3
• Gene ID (NCBI): 810
• RRID: AB_2878374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27482
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.