CALML4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CALML4 Polyclonal antibody (15894-1-AP)

• Featured Product
• KD/KO Validated

CALML4 Polyclonal Antibody for WB, IP, ELISA

Cat No. 15894-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, ELISA

Synonyms

calmodulin like 4, Calmodulin like protein 4, Calmodulin-like protein 4, NY BR 20, Serologically defined breast cancer antigen NY-BR-20

• 

  WB analysis using 15894-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15894-1-AP (CALML4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 15894-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 15894-1-AP (CALML4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human colon using 15894-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 15894-1-AP (CALML4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse thymus using 15894-1-AP

  IP result of anti-CALML4 (IP:15894-1-AP, 4ug; Detection:15894-1-AP 1:300) with mouse thymus tissue lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, human colon tissue, mouse thymus tissue, rat kidney tissue
• Positive IP detected in: mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15894-1-AP targets CALML4 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8705

  Product name: Recombinant human CALML4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-196 aa of BC009516

  Sequence: QPRPQNEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY

• Full Name: calmodulin-like 4
• Calculated Molecular Weight: 196 aa, 22 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC009516
• Gene Symbol: CALML4
• Gene ID (NCBI): 91860
• RRID: AB_2069462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GE6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALML4 (Calmodulin-Like Protein 4) is a small EF-hand protein encoded by the CALML4 gene located at human chromosome 15q23, which functions primarily as a myosin light chain within the intermicrovillar adhesion complex (IMAC) essential for epithelial brush border differentiation, where it binds to the neck region of the motor protein MYO7B to mediate microvilli organization and length control. Structurally, the longest isoform comprises 196 amino acids with a bilobed EF-hand architecture (N-lobe and C-lobe) and calcium‑binding capacity, although five alternatively spliced isoforms exist, some lacking an intact N-lobe. CALML4 is broadly expressed, with highest levels in the colon and duodenum, and is localized at the distal tips of intestinal microvilli. Clinically, common genetic variants in CALML4 have been investigated for their association with antidepressant efficacy in major depressive disorder, while its role in brush border assembly underscores its physiological importance in intestinal epithelia.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	ACS Chem Neurosci; Tetrahydropalmatine Regulates BDNF through TrkB/CAM Interaction to Alleviate the Neurotoxicity Induced by Methamphetamine.; Authors - Lian Liu
human	WB,IF	J Biol Chem; The small EF-hand protein CALML4 functions as a critical myosin light chain within the intermicrovillar adhesion complex.; Authors - Myoung Soo Choi ; KD Validated
human	WB	J Biol Chem; Molecular Regulatory Mechanism of Human Myosin-7a; Authors - Alexandra Holló