CALML4 Polyclonal antibody

• 

  WB analysis using 15894-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15894-1-AP (CALML4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human colon using 15894-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 15894-1-AP (CALML4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 15894-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 15894-1-AP (CALML4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse thymus using 15894-1-AP

  IP result of anti-CALML4 (IP:15894-1-AP, 4ug; Detection:15894-1-AP 1:300) with mouse thymus tissue lysate 2800ug.

• Featured Product
• KD/KO Validated

CALML4 Polyclonal Antibody for WB, IP, ELISA

Cat No. 15894-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, ELISA

Synonyms

CALML4, calmodulin like 4, Calmodulin like protein 4, NY BR 20

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse thymus tissue, human colon tissue, rat kidney tissue
• Positive IP detected in: mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below

Product Information

15894-1-AP targets CALML4 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8705

  Product name: Recombinant human CALML4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-196 aa of BC009516

  Sequence: QPRPQNEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY

• Full Name: calmodulin-like 4
• Calculated Molecular Weight: 196 aa, 22 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC009516
• Gene Symbol: CALML4
• Gene ID (NCBI): 91860
• RRID: AB_2069462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GE6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	ACS Chem Neurosci; Tetrahydropalmatine Regulates BDNF through TrkB/CAM Interaction to Alleviate the Neurotoxicity Induced by Methamphetamine.; Authors - Lian Liu
human	WB,IF	J Biol Chem; The small EF-hand protein CALML4 functions as a critical myosin light chain within the intermicrovillar adhesion complex.; Authors - Myoung Soo Choi ; KD Validated
human	WB	J Biol Chem; Molecular Regulatory Mechanism of Human Myosin-7a; Authors - Alexandra Holló