CALR3 Polyclonal antibody

• 

  WB analysis of mouse testis using 17064-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17064-1-AP (CALR3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 17064-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17064-1-AP (CALR3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 17064-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17064-1-AP (CALR3 Antibody) at dilution of 1:50 (under 40x lens).

CALR3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17064-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CALR3, Calreticulin 2, calreticulin 3, Calreticulin-3, Calsperin, CRT2

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17064-1-AP targets CALR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10847

  Product name: Recombinant human CALR3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-384 aa of BC014595

  Sequence: MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

• Full Name: calreticulin 3
• Calculated Molecular Weight: 384 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC014595
• Gene Symbol: CALR3
• Gene ID (NCBI): 125972
• RRID: AB_2243959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96L12
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.