CAMKK2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82720-14-RR (same clone as 82720-14-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82720-14-RR (CAMKK2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82720-14-PBS in a different storage buffer formulation.

• 

  WB analysis using 82720-14-RR (same clone as 82720-14-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82720-14-RR (CAMKK2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82720-14-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 82720-14-RR (same clone as 82720-14-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82720-14-RR (CAMKK2 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82720-14-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 82720-14-RR (same clone as 82720-14-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using CAMKK2 antibody (82720-14-RR, Clone: 251379E8 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 82720-14-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82720-14-RR

  Biolayer interferometry (BLl) kinetic assays of 82720-14-RR against Human CAMKK2 were performed. The affinity constant is below 1 pM

CAMKK2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 82720-14-PBS

Clone No.251379E8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Calcium/calmodulin-dependent protein kinase kinase 2, Calcium/calmodulin-dependent protein kinase kinase beta, CaM kinase kinase 2, CaM kinase kinase beta, CaM KK 2

---

Product Information

82720-14-PBS targets CAMKK2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2093

  Product name: Recombinant human CAMKK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC026060

  Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAF

• Full Name: calcium/calmodulin-dependent protein kinase kinase 2, beta
• Calculated Molecular Weight: 588 aa, 60 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC026060
• Gene Symbol: CAMKK2
• Gene ID (NCBI): 10645
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RR4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CAMKK2(calcium/calmodulin-dependent protein kinase kinase 2) is also named as CAMKKB, KIAA0787 and belongs to the protein kinase superfamily. It regulates hypothalamic production of the orexigenic hormone NPY and contributes to the regulation of energy balance. CAMKK2 in vivo reduces tumor growth suggests that reactivation of CAMKK2 by development of new drugs may be a new strategy to prolong the period to respond androgen-deprivation therapy(ADT)(PMID:22549914). It can be autophosphorylated(PMID:19369195). It has 7 isoforms produced by alternative splicing.