CAMP Recombinant monoclonal antibody, PBS Only

CAMP Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 82940-1-PBS
Clone No.230157B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

CAP18, 230157B4, Antibacterial peptide FALL-39, Antibacterial peptide FF-33, Antibacterial peptide KR-20

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82940-1-PBS targets CAMP in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2622

Product name: Recombinant human CAMP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-170 aa of BC055089

Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Predict reactive species
Full Name cathelicidin antimicrobial peptide
Calculated Molecular Weight 170 aa, 19 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC055089
Gene Symbol CAMP
Gene ID (NCBI) 820
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49913
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.

Loading...
||
New chat Able
正在加载,请稍候...