CAMP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human saliva using 82940-1-RR (same clone as 82940-1-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 82940-1-RR (CAMP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82940-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 82940-1-RR (same clone as 82940-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 82940-1-RR (CAMP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82940-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82940-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 82940-1-PBS against Human CAMP was performed. The affinity constant is below 1 pM.

• 

  Affinity and Kinetic Characterization of 82940-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82940-1-RR against Human ADAMDEC1 were performed. The affinity constant is 98.4 pM.

CAMP Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82940-1-PBS

Clone No.230157B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

CAP18, 230157B4, Antibacterial peptide FALL-39, Antibacterial peptide FF-33, Antibacterial peptide KR-20

---

Product Information

82940-1-PBS targets CAMP in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2622

  Product name: Recombinant human CAMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC055089

  Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

• Full Name: cathelicidin antimicrobial peptide
• Calculated Molecular Weight: 170 aa, 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC055089
• Gene Symbol: CAMP
• Gene ID (NCBI): 820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49913
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.