CAMSAP2 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66463-1-Ig (same clone as 66463-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66463-1-Ig (CAMSAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66463-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66463-1-Ig (same clone as 66463-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66463-1-Ig (CAMSAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66463-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 66463-1-Ig (same clone as 66463-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66463-1-Ig (CAMSAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66463-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66463-1-Ig (same clone as 66463-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66463-1-Ig (CAMSAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66463-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 66463-1-Ig (same clone as 66463-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 66463-1-Ig (CAMSAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66463-1-PBS in a different storage buffer formulation.

CAMSAP2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66463-1-PBS

Clone No.2A10A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CAMSAP1L1, CAMSAP2, KIAA1078

---

Product Information

66463-1-PBS targets CAMSAP2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11794

  Product name: Recombinant human CAMSAP1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 551-904 aa of BC065508

  Sequence: KADVPVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVVKQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA

• Full Name: calmodulin regulated spectrin-associated protein 1-like 1
• Calculated Molecular Weight: 1478 aa, 167 kDa
• Observed Molecular Weight: 170-200 kDa
• GenBank Accession Number: BC065508
• Gene Symbol: CAMSAP2
• Gene ID (NCBI): 23271
• RRID: AB_2881831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q08AD1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CAMSAP2, also known as CAMSAP1L1, is a microtubule minus-end binding protein, and is required for proper microtubule organization in neurons. CAMSAP2 stabilizes noncentrosomal microtubules and is important for neuronal polarity, axon specification, and dendritic branch formation.