CAND1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CAND1 Polyclonal antibody, PBS Only (32282-1-PBS)

• 

  WB analysis using 32282-1-AP (same clone as 32282-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32282-1-AP (CAND1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32282-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 32282-1-AP (same clone as 32282-1-PBS)

  IP result of anti-CAND1 (IP:32282-1-AP, 4ug; Detection:32282-1-AP 1:2000) with HEK-293 cells lysate 1280 ug. This data was developed using the same antibody clone with 32282-1-PBS in a different storage buffer formulation.

CAND1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 32282-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

Cullin-associated and neddylation-dissociated protein 1, Cullin-associated NEDD8-dissociated protein 1, KIAA0829, p120 CAND1, TBP-interacting protein 120A

---

Product Information

32282-1-PBS targets CAND1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35297

  Product name: Recombinant human CAND1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 396-586 aa of NM_018448

  Sequence: HAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVK

• Full Name: cullin-associated and neddylation-dissociated 1
• Calculated Molecular Weight: 136 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_018448
• Gene Symbol: CAND1
• Gene ID (NCBI): 55832
• RRID: AB_3742567
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86VP6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CAND1 (Cullin-Associated and Neddylation-Dissociated 1) is a key regulatory protein involved in the proper functioning of the CRL (Cullin-RING ubiquitin ligase) family, which plays a crucial role in ubiquitin-mediated protein degradation (PMID: 18444905).