CAPN5 Polyclonal antibody

• 

  WB analysis using 29809-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29809-1-AP (CAPN5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29809-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29809-1-AP (CAPN5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

CAPN5 Polyclonal Antibody for WB, ELISA

Cat No. 29809-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

WB, ELISA

Synonyms

calpain 5, Calpain htra 3, CAPN5, FLJ46245, HTRA3, nCL 3, NCL3, New calpain 3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, A431 cells, mouse colon tissue, A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, SH-SY5Y cells, SKOV-3 cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29809-1-AP targets CAPN5 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30479

  Product name: Recombinant human CAPN5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-105 aa of BC018123

  Sequence: MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWK

• Full Name: calpain 5
• Calculated Molecular Weight: 640 aa, 73 kDa
• Observed Molecular Weight: 65-73 kDa
• GenBank Accession Number: BC018123
• Gene Symbol: CAPN5
• Gene ID (NCBI): 726
• RRID: AB_3086169
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15484
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calpain-5 is a protein that in humans is encoded by the CAPN5 gene. Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called HTRA3.