Calpain S2 Polyclonal antibody

Calpain S2 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 15803-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

CAPNS2, CSS2, calpain, small subunit 2, Calpain small subunit 2, Calcium-dependent protease small subunit 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skin tissue, rat skin tissue
Positive IP detected inmouse skin tissue
Positive IHC detected inhuman skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15803-1-AP targets Calpain S2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8534

Product name: Recombinant human CAPNS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 5-248 aa of BC005397

Sequence: KALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS

Predict reactive species
Full Name calpain, small subunit 2
Calculated Molecular Weight 248 aa, 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC005397
Gene Symbol Calpain S2
Gene ID (NCBI) 84290
RRIDAB_2259580
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96L46
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calpain S2, also known as calpain-2, is a member of the calpain family of calcium-dependent proteases that play crucial roles in various cellular processes.

Protocols

Product Specific Protocols
IHC protocol for Calpain S2 antibody 15803-1-APDownload protocol
IP protocol for Calpain S2 antibody 15803-1-APDownload protocol
WB protocol for Calpain S2 antibody 15803-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...