CAPSL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CAPSL Polyclonal antibody (17174-1-AP)

CAPSL Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17174-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Calcyphosin like protein, calcyphosine like, CAPSL

• 

  WB analysis of mouse lung using 17174-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 17174-1-AP (CAPSL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 17174-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 17174-1-AP (CAPSL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse lung using 17174-1-AP

  IP result of anti-CAPSL (IP:17174-1-AP, 4ug; Detection:17174-1-AP 1:500) with mouse lung tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 17174-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 17174-1-AP (CAPSL antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 17174-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 17174-1-AP (CAPSL antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CAPSL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17174-1-AP targets CAPSL in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10771

  Product name: Recombinant human CAPSL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC017586

  Sequence: MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL

• Full Name: calcyphosine-like
• Calculated Molecular Weight: 198 aa, 23 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC017586
• Gene Symbol: CAPSL
• Gene ID (NCBI): 133690
• RRID: AB_2070031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWF8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CAPSL Polyclonal antibody (Cat# 17174-1-AP) has 2 total citations. These appear in Scientific Reports and Science. The cited research covers adipogenesis and multiple symmetric lipomatosis, as well as ciliary transition zone structure and primary ciliary dyskinesia.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Rep; Calcyphosine-like (CAPSL) is regulated in Multiple Symmetric Lipomatosis and is involved in Adipogenesis.; Authors - Angie Lindner
		Science; In situ structure of the human ciliary transition zone links linker defects to primary ciliary dyskinesia.; Authors - Haixia Zhou