CARD10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CARD10 Polyclonal antibody (32374-1-AP)

• 

  IHC staining of human colon cancer using 32374-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 32374-1-AP (CARD10 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CARD10 Polyclonal Antibody for IHC, ELISA

Cat No. 32374-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

BIMP1, CARD-containing MAGUK protein 3, Carma 3, CARMA3, Caspase recruitment domain-containing protein 10

---

Tested Applications

• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32374-1-AP targets CARD10 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36178

  Product name: Recombinant human CARD10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 345-632 aa of BC113659

  Sequence: ELQWAEELRDQYLQEMEDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPAPPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAV

• Full Name: caspase recruitment domain family, member 10
• Calculated Molecular Weight: 1032 aa, 116 kDa
• GenBank Accession Number: BC113659
• Gene Symbol: CARD10
• Gene ID (NCBI): 29775
• RRID: AB_3742584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BWT7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caspase recruitment domain family member 11 (CARD11) belongs to the CARD protein family; it can bind with B-cell CLL/lymphoma 10 and activate the inflammation-associated nuclear factor κB (NF-κB) signaling pathway. Furthermore, CARD11 also acts as a scaffold protein to assist the assembly of multiprotein signaling molecules in the plasma membrane. (PMID: 31939627, PMID: 29928437)