CARD11 Monoclonal antibody, PBS Only

• 

  WB analysis using 68269-1-Ig (same clone as 68269-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68269-1-Ig (CARD11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68269-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 68269-1-Ig (same clone as 68269-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 68269-1-Ig (CARD11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68269-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 68269-1-Ig (same clone as 68269-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed L02 cells using CARD11 antibody (68269-1-Ig, Clone: 3F5H6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68269-1-PBS in a different storage buffer formulation.

CARD11 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68269-1-PBS

Clone No.3F5H6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

BIMP3, CARD11, Carma 1, CARMA1

---

Product Information

68269-1-PBS targets CARD11 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16468

  Product name: Recombinant human CARD11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 798-1147 aa of BC111719

  Sequence: DTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL

• Full Name: caspase recruitment domain family, member 11
• Calculated Molecular Weight: 1154 aa, 133 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC111719
• Gene Symbol: CARD11
• Gene ID (NCBI): 84433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BXL7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CARD11 also named as ,BIMP3 or CARMA1, is a 1154 amino acid protein, which contains one PDZ domain, one guanylate kinase-like domain, and one CARD domain. CARD11 localizes in the cytoplasm and co-localized with DPP4 in membrane raft. CARD11 is detected in adult peripheral blood leukocytes, thymus, spleen and liver. CARD11 also is found in CARD11 promyelocytic leukemia HL-60 cells, chronic myelogenous leukemia K-562 cells, Burkitt's lymphoma Raji cells and colorectal adenocarcinoma SW480 cells. CARD11 is involved in the co-stimulatory signal essential for T-cell receptor mediated T-cell activation.