CARTPT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CARTPT Polyclonal antibody, PBS Only (13212-1-PBS)

• 

  WB analysis of SH-SY5Y using 13212-1-AP (same clone as 13212-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13212-1-AP (CARTPT antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13212-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human adrenal gland using 13212-1-AP (same clone as 13212-1-PBS)

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 13212-1-AP (CARTPT antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13212-1-PBS in a different storage buffer formulation.

CARTPT Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13212-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13212-1-PBS targets CARTPT in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4004

  Product name: Recombinant human CARTPT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-116 aa of BC029882

  Sequence: AQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

• Full Name: CART prepropeptide
• Calculated Molecular Weight: 116 aa, 13 kDa
• Observed Molecular Weight: 4-14 kDa
• GenBank Accession Number: BC029882
• Gene Symbol: CARTPT
• Gene ID (NCBI): 9607
• RRID: AB_10666161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16568
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.