Use Able AI chat for product recommendations

Calsequestrin 2 Recombinant monoclonal antibody, PBS Only

Calsequestrin 2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84056-6-PBS
Clone No.241211A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

CASQ2, 241211A3, Calsequestrin-2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84056-6-PBS targets Calsequestrin 2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33584

Product name: Recombinant human CASQ2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-399 aa of BC022288

Sequence: MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE*

Predict reactive species
Full Name calsequestrin 2 (cardiac muscle)
Calculated Molecular Weight 46 kDa
Observed Molecular Weight 46-55 kDa
GenBank Accession NumberBC022288
Gene Symbol Calsequestrin 2
Gene ID (NCBI) 845
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO14958
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Calsequestrin (CASQ) is a Ca2+-binding protein present primarily in junctional sarcoplasmic reticulum of skeletal and cardiac muscle; the cardiac form (CASQ2) is encoded by a separate gene. The primary role of CASQ2 is buffering of the sarcoplasmic reticulum Ca2+ ions, but another role for CASQ2 has emerged recently: CASQ2 regulates the open probability of ryanodine receptor 2 (RyR2). Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.

Loading...
||
New chat

Able

正在加载,请稍候...