Calsequestrin 2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84056-6-RR (same clone as 84056-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84056-6-RR (CASQ2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84056-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 84056-6-RR (same clone as 84056-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84056-6-RR (CASQ2 antibody) at dilution of 1:0 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84056-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 84056-6-RR (same clone as 84056-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84056-6-RR (CASQ2 antibody) at dilution of 1:0 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84056-6-PBS in a different storage buffer formulation.

• 

  IF Staining of C2C12 using 84056-6-RR (same clone as 84056-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using CASQ2 antibody (84056-6-RR, Clone: 241211A3 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84056-6-PBS in a different storage buffer formulation.

• 

  IF Staining of C2C12 using 84056-6-RR (same clone as 84056-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using CASQ2 antibody (84056-6-RR, Clone: 241211A3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84056-6-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 84056-6-RR (same clone as 84056-6-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug CASQ2 Recombinant antibody (84056-6-RR, Clone:241211A3) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84056-6-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 84056-6-RR (same clone as 84056-6-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug CASQ2 Recombinant antibody (84056-6-RR, Clone:241211A3) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84056-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84056-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84056-6-RR against Human CASQ2 were performed. The affinity constant is 0.251 nM.

Calsequestrin 2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84056-6-PBS

Clone No.241211A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

CASQ2, 241211A3, Calsequestrin-2

---

Product Information

84056-6-PBS targets Calsequestrin 2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33584

  Product name: Recombinant human CASQ2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-399 aa of BC022288

  Sequence: MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE*

• Full Name: calsequestrin 2 (cardiac muscle)
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46-55 kDa
• GenBank Accession Number: BC022288
• Gene Symbol: Calsequestrin 2
• Gene ID (NCBI): 845
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O14958
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calsequestrin (CASQ) is a Ca2+-binding protein present primarily in junctional sarcoplasmic reticulum of skeletal and cardiac muscle; the cardiac form (CASQ2) is encoded by a separate gene. The primary role of CASQ2 is buffering of the sarcoplasmic reticulum Ca2+ ions, but another role for CASQ2 has emerged recently: CASQ2 regulates the open probability of ryanodine receptor 2 (RyR2). Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.