CASZ1 Polyclonal antibody

CASZ1 Polyclonal Antibody for WB, ELISA
Cat No. 14534-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Castor related protein, castor zinc finger 1, CASZ1, CST, SRG, Zinc finger protein 693, ZNF693

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSMMC-7721 cells, C2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14534-1-AP targets CASZ1 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6035

Product name: Recombinant human CASZ1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 818-1166 aa of BC051883

Sequence: PSLLGAVSSGSAASATPDTPTLVASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVTPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNKMSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCDGQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKPPMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLPASPLATTSLENAKPQVKPGFLQFQEK

Predict reactive species
Full Name castor zinc finger 1
Calculated Molecular Weight 190 kDa
Observed Molecular Weight150 kDa, 250 kDa
GenBank Accession NumberBC051883
Gene Symbol CASZ1
Gene ID (NCBI) 54897
RRIDAB_3669188
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86V15
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zinc finger protein castor homolog 1 (CASZ1), also known as zinc finger protein 693 (ZNF693), belongs to the C2H2-type zinc finger protein family. CASZ1 is a transcription factor that is evolutionarily conserved and participates in multiple embryonic development and physiological processes. CASZ1 has been found to regulate aldosterone synthesis and repress the activation of aldosterone target genes, suggesting that it may participate in blood pressure regulation. CASZ1 is ubiquitously expressed in various embryonic tissues. Subcellularly, CASZ1 is usually localized in the cell nucleus, consistent with its role in transcription regulation (PMID: 37509718). CASZ1 has two isoforms namely CASZ1a (i.e., hcasz11, 190 kDa) and CASZ1b (i.e., hcasz5, 125 kDa). The observed molecular weights were 150 kDa and 250 kDa, respectively, consistent with descriptions in the literature (PMID: 32060262).

Protocols

Product Specific Protocols
WB protocol for CASZ1 antibody 14534-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...