CATSPER2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CATSPER2 Polyclonal antibody (26890-1-AP)

• 

  WB analysis using 26890-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26890-1-AP (CATSPER2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CATSPER2 Polyclonal Antibody for WB, ELISA

Cat No. 26890-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Cation channel sperm-associated protein 2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26890-1-AP targets CATSPER2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25283

  Product name: Recombinant human CATSPER2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC064387

  Sequence: MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLF

• Full Name: cation channel, sperm associated 2
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC064387
• Gene Symbol: CATSPER2
• Gene ID (NCBI): 117155
• RRID: AB_3742203
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cation channel sperm-associated protein 2 (CATSPER2) is a pore-forming subunit of the CatSper complex, a sperm-specific voltage-gated calcium channel, that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome reaction and chemotaxis towards the oocyte (PMID: 21412338; 21412339).