Product Information
60859-1-PBS targets CAV1 as part of a matched antibody pair:
MP51272-1: 66067-2-PBS capture and 60859-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11052 Product name: Recombinant human CAV1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC009685 Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYR Predict reactive species |
| Full Name | caveolin 1, caveolae protein, 22kDa |
| Calculated Molecular Weight | 178 aa, 20 kDa |
| GenBank Accession Number | BC009685 |
| Gene Symbol | CAV1 |
| Gene ID (NCBI) | 857 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q03135 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





