CBR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CBR1 Polyclonal antibody, PBS Only (31279-1-PBS)

• 

  WB analysis using 31279-1-AP (same clone as 31279-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31279-1-AP (CBR1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31279-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 31279-1-AP (same clone as 31279-1-PBS)

  IP result of anti-CBR1 (IP:31279-1-AP, 4ug; Detection:31279-1-AP 1:5000) with HeLa cells lysate 980 ug. This data was developed using the same antibody clone with 31279-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31279-1-AP (same clone as 31279-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CBR1 antibody (31279-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31279-1-PBS in a different storage buffer formulation.

CBR1 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 31279-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

EC:1.1.1.189, EC:1.1.1.184, carbonyl reductase 1, Alcohol dehydrogenase [NAD(P)+] CBR1, 20-beta-hydroxysteroid dehydrogenase

---

Product Information

31279-1-PBS targets CBR1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34830

  Product name: Recombinant human CBR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-276 aa of BC002511

  Sequence: MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQ

• Full Name: carbonyl reductase 1
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC002511
• Gene Symbol: CBR1
• Gene ID (NCBI): 873
• RRID: AB_3669926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16152
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CBR1 belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics.