Tested Applications
| Positive WB detected in | A431 cells, MCF-7 cells, HEK-293 cells, human brain tissue, NIH/3T3 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach cancer tissue, mouse testis tissue, human colon cancer tissue, human lung cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10241-2-AP targets CBX1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0328 Product name: Recombinant human CBX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-185 aa of BC002609 Sequence: NKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN Predict reactive species |
| Full Name | chromobox homolog 1 (HP1 beta homolog Drosophila ) |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC002609 |
| Gene Symbol | CBX1 |
| Gene ID (NCBI) | 10951 |
| RRID | AB_2228586 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P83916 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
One function of heterochromatin is the epigenetic silencing by sequestration of genes into transcriptionally repressed nuclear neighborhoods. Heterochromatin protein 1 (HP1) is a major component of heterochromatin and is a candidate for establishing and mediating gene silencing. This protein is expressed in all adult and embryonic tissues, as a homodimer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CBX1 antibody 10241-2-AP | Download protocol |
| IHC protocol for CBX1 antibody 10241-2-AP | Download protocol |
| IP protocol for CBX1 antibody 10241-2-AP | Download protocol |
| WB protocol for CBX1 antibody 10241-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CBX1 Polyclonal antibody (Cat# 10241-2-AP) has 14 citations spanning journals including Nature Communications, Advanced Science, Science Advances, Cancer Letters, Journal of Experimental Medicine, Journal of Cell Biology, Journal of Virology, Pediatric Research, Frontiers in Genetics, Oncology Letters, and Genes & Cells. Research fields covered include epigenetics and chromatin biology, oncology (nasopharyngeal, osteosarcoma, esophageal, bladder, and myeloid cancers), cardiovascular disease, neuropathic pain, HIV-1 latency, telomere biology, and aging.
| Species | Application | Title |
|---|---|---|
Nat Commun The histone H3K9 methyltransferase SUV39H links SIRT1 repression to myocardial infarction. | ||
Nat Commun Improving erectile function in diabetic male mice by rescuing depalmitoylated FBP1 to reduce cavernosal lactate. | ||
Nat Commun LSM1-mediated Major Satellite RNA decay is required for nonequilibrium histone H3.3 incorporation into parental pronuclei | ||
Adv Sci (Weinh) N6 -Methyladenosine-Modified CBX1 Regulates Nasopharyngeal Carcinoma Progression Through Heterochromatin Formation and STAT1 Activation | ||
Sci Adv CK2-dependent degradation of CBX3 dictates replication fork stalling and PARP inhibitor sensitivity | ||
Cancer Lett HP1 enhances radio- and chemotherapy resistance in osteosarcoma via PARP1-dependent transcriptional repression and HR repair.
|
Reviews
What customers say
The single review for this product reports a 5-star rating from a Western Blot experiment performed on mouse heart tissue at a 1:1000 dilution. The reviewer noted that the antibody produced a band at the predicted molecular weight, confirming specific and reliable detection under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
WEI (Verified Customer) (03-08-2022) | Band at predicted size
|
