CBX2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68244-1-Ig (same clone as 68244-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68244-1-Ig (CBX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68244-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 68244-1-Ig (same clone as 68244-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CBX2 antibody (68244-1-Ig, Clone: 1D3H3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68244-1-PBS in a different storage buffer formulation.

CBX2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68244-1-PBS

Clone No.1D3H3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

SRXY5, M33, CDCA6, 1D3H3

---

Product Information

68244-1-PBS targets CBX2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8311

  Product name: Recombinant human CBX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-211 aa of BC004252

  Sequence: MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACVQ

• Full Name: chromobox homolog 2 (Pc class homolog, Drosophila)
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC004252
• Gene Symbol: CBX2
• Gene ID (NCBI): 84733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14781
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The chromobox homolog protein 2 (CBX2) is a critical component of the PRC1 complex involved in antiviral innate immunity, neuronal, and gonadal differentiation, axial patterning during embryonic development, cell proliferation, and senescence (PMID: 32870972). CBX2 has 2 isoforms with the molecular mass of 23 and 56 kDa. Sometimes higher molecular weight around 65-70 kDa can also be observed, which may be a modified variant of CBX2.