CBX6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CBX6 Polyclonal antibody (23426-1-AP)

CBX6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23426-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

CBX6, chromobox homolog 6, Chromobox protein homolog 6

• 

  WB analysis of HepG2 using 23426-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23426-1-AP (CBX6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 23426-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23426-1-AP (CBX6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 23426-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23426-1-AP (CBX6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 23426-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23426-1-AP (CBX6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 23426-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin slide using 23426-1-AP (CBX6 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 23426-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin slide using 23426-1-AP (CBX6 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CBX6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells
• Positive IHC detected in: human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23426-1-AP targets CBX6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20014

  Product name: Recombinant human CBX6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 89-336 aa of BC064900

  Sequence: ALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAA

• Full Name: chromobox homolog 6
• Calculated Molecular Weight: 412 aa, 44 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC064900
• Gene Symbol: CBX6
• Gene ID (NCBI): 23466
• RRID: AB_2737364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95503
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Chromobox domain (Cbx) gene family, consisting of Polycomb and Heterochromatin Protein 1 genes, involves in transcriptional repression, cell cycle regulation and chromatin remodeling [PMID: 17486619]. Cbx6, other named neuronal pentraxin receptor (NPR), first described as a putative integral membrane pentraxin that interacts with neuronal pentraxin 1 and 2, has also been classified as a Pc protein [PMID: 14647293]. NPR was determined to be a member of a distinct pentraxin protein subfamily, and found to form heteropentamer swithNP1 andNP2, followed by release from cell membranes [PMID: 10748068].

Publications

What published studies show

CBX6 Polyclonal antibody (Cat# 23426-1-AP) has 3 total citations published in Cell, Cell Communications and Signaling, and Biochemical and Biophysical Research Communications. The associated research fields include epigenetics and solid tumor therapeutics, vascular smooth muscle cell plasticity in intrauterine growth restriction, and cell aging with bronchial asthma gene identification.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Targeting Epigenetic Crosstalk as a Therapeutic Strategy for EZH2-Aberrant Solid Tumors.; Authors - Xun Huang
		Cell Commun Signal; Trophoblast cells rewire the epigenetic landscape of vascular smooth muscle cells to modulate plasticity: a regulatory axis disrupted in intrauterine growth restriction.; Authors - Poulomi Sarkar
rat	WB	Biochem Biophys Res Commun; The identification of potentially key genes in cell aging and bronchial asthma by integrated bioinformatics analysis.; Authors - Lingyu pan