CBX7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CBX7 Polyclonal antibody (26278-1-AP)

• Featured Product
• KD/KO Validated

CBX7 Polyclonal Antibody for WB, ELISA

Cat No. 26278-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

chromobox homolog 7, Chromobox protein homolog 7

• 

  WB analysis of mouse liver using 26278-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26278-1-AP (CBX7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CBX7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26278-1-AP targets CBX7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24588

  Product name: Recombinant human CBX7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 82-250 aa of BC051773

  Sequence: QRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQPAEGFFRDRSGKF

• Full Name: chromobox homolog 7
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 22-36 kDa
• GenBank Accession Number: BC051773
• Gene Symbol: CBX7
• Gene ID (NCBI): 23492
• RRID: AB_2880459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95931
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-CBX7 (Cat# 26278-1-AP) has 10 total citations published in journals including Int J Biol Sci, Dev Cell, Br J Cancer, Tissue Eng Regen Med, Mol Carcinog, Am J Cancer Res, Front Genet, Biochem Biophys Res Commun, Onco Targets Ther, and Oncol Lett. Research fields span multiple cancer types (renal cell, bladder, ovarian, pancreatic, esophageal, lung), stem cell biology, and neural development.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Int J Biol Sci; The RNF26/CBX7 axis modulates the TNF pathway to promote cell proliferation and regulate sensitivity to TKIs in ccRCC.; Authors - Wentao Liu ; KD Validated
		Dev Cell; Nucleoporin Seh1 controls murine neocortical development via transcriptional repression of p21 in neural stem cells; Authors - Wenxiu Dai
human	WB,IP,IHC	Br J Cancer; Downregulation of CBX7 induced by EZH2 upregulates FGFR3 expression to reduce sensitivity to cisplatin in bladder cancer; Authors - Jiannan Ren
human	WB	Tissue Eng Regen Med; CBX7 Rejuvenates Late Passage Dental Pulp Stem Cells by Maintaining Stemness and Pro-angiogenic Ability; Authors - Yu Wu
human	WB	Mol Carcinog; Loss of CBX2 causes genomic instability and Wnt activation in high grade serous ovarian carcinoma cells; Authors - Yujia Ma
human	WB	Am J Cancer Res; Circ_0006790 carried by bone marrow mesenchymal stem cell-derived exosomes regulates S100A11 DNA methylation through binding to CBX7 in pancreatic ductal adenocarcinoma.; Authors - Ge Gao