CBX7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CBX7 Polyclonal antibody, PBS Only (26278-1-PBS)

• 

  WB analysis of mouse liver using 26278-1-AP (same clone as 26278-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26278-1-AP (CBX7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26278-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CBX7 Polyclonal Antibody for WB, ELISA

Cat No. 26278-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Synonyms

chromobox homolog 7, Chromobox protein homolog 7

---

Product Information

26278-1-PBS targets CBX7 in applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24588

  Product name: Recombinant human CBX7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 82-250 aa of BC051773

  Sequence: QRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQPAEGFFRDRSGKF

• Full Name: chromobox homolog 7
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC051773
• Gene Symbol: CBX7
• Gene ID (NCBI): 23492
• RRID: AB_2880459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95931
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.