• Featured Product
  • KD/KO Validated

CC2D1A Monoclonal antibody

CC2D1A Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68334-1-Ig
Clone No.1C11G2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

FREUD 1, AKI1, Akt kinase-interacting protein 1, Coiled-coil and C2 domain-containing protein 1A, Five prime repressor element under dual repression-binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HEK-293 cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68334-1-Ig targets CC2D1A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10363

Product name: Recombinant human CC2D1A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-351 aa of BC064981

Sequence: MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLEA

Predict reactive species
Full Name coiled-coil and C2 domain containing 1A
Calculated Molecular Weight 951 aa, 104 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC064981
Gene Symbol CC2D1A
Gene ID (NCBI) 54862
RRIDAB_3085058
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ6P1N0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CC2D1A (coiled-coil and C2 domain-containing 1A), also known as Freud-1, Aki1 or TAPE (TBK1-associated protein in endolysosomes), is a evolutionary conserved protein located in different subcellular compartments, including the nucleus, centrosome, and endolysosomes. It acts as a scaffold protein that interacts with various proteins and plays diverse biological roles. Mutations in CC2D1A have been linked to nonsyndromic mental retardation (NMSR) and generate a truncated 85-kDa product. Several isoforms of CC2D1A proteins have also been described: 120 /130-kDa doublet of long isoform and 67 kDa short isoform. The short isoform of CC2D1A has been identified as the predominant isoform in rodent cells, while the long isoform is more abundant in human cells. Recently it has been reported that CC2D1A/TAPE is the first innate immune regulator implicated in both TLR and RLR signaling at a very early step.

Protocols

Product Specific Protocols
IF protocol for CC2D1A antibody 68334-1-IgDownload protocol
IHC protocol for CC2D1A antibody 68334-1-IgDownload protocol
WB protocol for CC2D1A antibody 68334-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...