CCDC106 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC106 Polyclonal antibody, PBS Only (25965-1-PBS)

• 

  WB analysis using 25965-1-AP (same clone as 25965-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25965-1-AP (CCDC106 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25965-1-PBS in a different storage buffer formulation.

CCDC106 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25965-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CCDC 106, HSU79303, ZNF581

---

Product Information

25965-1-PBS targets CCDC106 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23115

  Product name: Recombinant human CCDC106 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-280 aa of BC000412

  Sequence: MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR

• Full Name: coiled-coil domain containing 106
• Calculated Molecular Weight: 280 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000412
• Gene Symbol: CCDC106
• Gene ID (NCBI): 29903
• RRID: AB_3742162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Coiled-coil domain containing 106 (CCDC106) is a protein containing 280 amino acids with a molecular weight of 32 kDa. The coiled-coil domain is involved in molecular recognition, DNA binding and secretion. CCDC106 was identified as a p53-interacting partner by automated yeast two-hybrid screening , but its sequence and interaction with p53 have not been further confirmed.(PMID: 35484984,PMID: 20159018)