CCDC114 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC114 Polyclonal antibody, PBS Only (27211-1-PBS)

• 

  WB analysis using 27211-1-AP (same clone as 27211-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27211-1-AP (CCDC114 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27211-1-PBS in a different storage buffer formulation.

CCDC114 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27211-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27211-1-PBS targets CCDC114 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26053

  Product name: Recombinant human CCDC114 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_144577

  Sequence: MEGERRAYSKEVHQRINKQLEEIRRLEEVRGDLQVQISAAQNQVKRLRDSQRLENMDRLLKGRAQVQAEIEELQEQTRALDKQIQEWETRIFTHSKNVRS

• Full Name: coiled-coil domain containing 114
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 65kDa
• GenBank Accession Number: NM_144577
• Gene Symbol: CCDC114
• Gene ID (NCBI): 93233
• RRID: AB_3085937
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96M63
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.