CCDC12 Polyclonal antibody

• 

  WB analysis of HeLa using 25138-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25138-1-AP (CCDC12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 25138-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 25138-1-AP (CCDC12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 25138-1-AP

  IP result of anti-CCDC12 (IP:25138-1-AP, 4ug; Detection:25138-1-AP 1:600) with HeLa cells lysate 2560ug.

• 

  IHC staining of human ovary tumor using 25138-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25138-1-AP (CCDC12 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 25138-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25138-1-AP (CCDC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 25138-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CCDC12 antibody (25138-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

CCDC12 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 25138-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CCDC12

---

Tested Applications

• Positive WB detected in: HeLa cells, Raji cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25138-1-AP targets CCDC12 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18223

  Product name: Recombinant human CCDC12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC020830

  Sequence: MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD

• Full Name: coiled-coil domain containing 12
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 18-25 kDa
• GenBank Accession Number: BC020830
• Gene Symbol: CCDC12
• Gene ID (NCBI): 151903
• RRID: AB_2879919
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WUD4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC12 is a 166aa protein with MW 18-25 kDa (with some modification).