CCDC137 Polyclonal antibody

• 

  WB analysis of PC-3 using 27201-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 27201-1-AP (CCDC137 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 27201-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27201-1-AP (CCDC137 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

CCDC137 Polyclonal Antibody for WB, ELISA

Cat No. 27201-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

CCDC137

---

Tested Applications

• Positive WB detected in: PC-3 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

27201-1-AP targets CCDC137 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23942

  Product name: Recombinant human CCDC137 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-289 aa of BC009369

  Sequence: MAGAGRGAAVSRVQAGPGSPRRARGRQQVQPLGKQRPAPWPGLRSKEKKKVNCKPKNQDEQEIPFRLREIMRSRQEMKNPISNKKRKKAAQVTFRKTLEKEAKGEEPDIAVPKFKQRKGESDGAYIHRMQQEAQHVLFLSKNQAIRQPEVQAAPKEKSEQKKAKKAFQKRRLDKVRRKKEEKAADRLEQELLRDTVKFGEVVLQPPELTARPQRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQL

• Full Name: coiled-coil domain containing 137
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC009369
• Gene Symbol: CCDC137
• Gene ID (NCBI): 339230
• RRID: AB_2880797
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PK04
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IF	J Exp Clin Cancer Res; RNA-binding protein CCDC137 activates AKT signaling and promotes hepatocellular carcinoma through a novel non-canonical role of DGCR8 in mRNA localization; Authors - Shuang Tao ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Arnaud (Verified Customer) (09-26-2025)

Difficult to see at 1:1000 dilution

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000 for WB
• Cell Tissue Type: HeLa