CCDC151 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC151 Polyclonal antibody, PBS Only (31680-1-PBS)

• 

  WB analysis using 31680-1-AP (same clone as 31680-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31680-1-AP (CCDC151 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31680-1-PBS in a different storage buffer formulation.

CCDC151 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31680-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Outer dynein arm-docking complex subunit 3

---

Product Information

31680-1-PBS targets CCDC151 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34867

  Product name: Recombinant human CCDC151 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 246-595 aa of BC141828

  Sequence: NRLDSMEAEVVRTKHELEALHVVNQEALNARDIAKNQLQYLEETLVRERKKRERYISECKKRAEEKKLENERMERKTHREHLLLQSDDTIQDSLHAKEEELRQRWSMYQMEVIFGKVKDATGTDETHSLVRRFLAQGDTFAQLETLKSENEQTLVRLKQEKQQLQRELEDLKYSGEATLVSQQKLQAEAQERLKKEERRHAEAKDQLERALRAMQVAKDSLEHLASKLIHITVEDGRFAGKELDPQADNYVPNLLGLVEEKLLKLQAQLQGHDVQEMLCHIANREFLASLEGRLPEYNTRIALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS

• Full Name: coiled-coil domain containing 151
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC141828
• Gene Symbol: CCDC151
• Gene ID (NCBI): 115948
• RRID: AB_3670074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A5D8V7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC151 (Coiled-coil domain-containing protein 151), also called ODAD3 (Outer dynein arm-docking complex subunit 3), is a component of the outer dynein arm-docking complex (ODA-DC) that mediates outer dynein arms (ODA) binding onto the doublet microtubule (PMID: 25192045). It is involved in mediating the assembly of both ODAs and their axonemal docking complex onto ciliary microtubules (PMID: 25192045).