CCDC23 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCDC23 Polyclonal antibody (30688-1-AP)

• 

  IHC staining of mouse skin using 30688-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 30688-1-AP (CCDC23 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 30688-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 30688-1-AP (CCDC23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CCDC23 Polyclonal Antibody for IHC, ELISA

Cat No. 30688-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

SVBP, Coiled coil domain-containing protein 23, Small vasohibin-binding protein

---

Tested Applications

• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30688-1-AP targets CCDC23 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33650

  Product name: Recombinant human CCDC23 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-66 aa of BC029427

  Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

• Full Name: coiled-coil domain containing 23
• GenBank Accession Number: BC029427
• Gene Symbol: CCDC23
• Gene ID (NCBI): 374969
• RRID: AB_3742367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N300
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC23 also known as SVBP is a small vasohibin-binding protein of 66 amino acids, and functions as a chaperone of VASH1 in vascular endothelial cells(PMID: 20736312). SVBP enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin(PMID: 29146869, 31171830). Mutations in SVBP cause Neurodevelopmental disorders with ataxia, hypotonia, and microcephaly (NEDAHM)(PMID: 30607023, 31363758).