CoraLite® Plus 488-conjugated CCDC23 Recombinant monoclonal antibody

• 

  IF Staining of U2OS using CL488-82998-4

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using CoraLite® Plus 488 CCDC23 antibody (CL488-82998-4, Clone: 230175B2 ) at dilution of 1:200.

CCDC23 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82998-4

Clone No.230175B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

SVBP, Small vasohibin-binding protein, Coiled coil domain-containing protein 23, 230175B2

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82998-4 targets CCDC23 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33650

  Product name: Recombinant human CCDC23 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-66 aa of BC029427

  Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

• Full Name: coiled-coil domain containing 23
• GenBank Accession Number: BC029427
• Gene Symbol: CCDC23
• Gene ID (NCBI): 374969
• RRID: AB_3673167
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N300
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CCDC23 also known as SVBP is a small vasohibin-binding protein of 66 amino acids, and functions as a chaperone of VASH1 in vascular endothelial cells(PMID: 20736312). SVBP enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin(PMID: 29146869, 31171830). Mutations in SVBP cause Neurodevelopmental disorders with ataxia, hypotonia, and microcephaly (NEDAHM)(PMID: 30607023, 31363758).