CCDC40 Polyclonal antibody

CCDC40 Polyclonal Antibody for WB, ELISA
Cat No. 25049-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

KIAA1640, Coiled-coil domain-containing protein 40

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, A549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25049-1-AP targets CCDC40 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20034

Product name: Recombinant human CCDC40 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 683-1031 aa of BC035251

Sequence: HTSSRLDAHQKTLVELDQDVKKVNELITNSQSEISRRTILIERKQGLINFLNKQLERMVSELGGEEVGPLELEIKRLSKLIDEHDGKAVQAQVTWLRLQQEMVKVTQEQEEQLASLDASKKELHIMEQKKLRVGSKIEQEKKEQKEIEHHMKDLDNDLKKLNMLMNKNRCSSEELEQNNRVTENEFVRSLKASERETIKMQDKLNQLSEEKATLLNQLVEAEHQIMLWEKKIQLAKEMRSSVDSEIGQTEIRAMKGEIHRMKKYCRTTRDARRHVHEQHGTRAGTCTNNTGRAQARARTTRDARRHVHEQHGTRAGTCTNNTGRAQARARTTRDARRHVHEHRTHTARA

Predict reactive species
Full Name coiled-coil domain containing 40
Calculated Molecular Weight 1142 aa, 130 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC035251
Gene Symbol CCDC40
Gene ID (NCBI) 55036
RRIDAB_2879870
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ4G0X9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for CCDC40 antibody 25049-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...