CCDC40 Polyclonal antibody

• 

  WB analysis of fetal human brain using 25049-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 25049-1-AP (CCDC40 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 25049-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 25049-1-AP (CCDC40 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CCDC40 Polyclonal Antibody for WB, ELISA

Cat No. 25049-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA1640, Coiled-coil domain-containing protein 40

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25049-1-AP targets CCDC40 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20034

  Product name: Recombinant human CCDC40 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 683-1031 aa of BC035251

  Sequence: HTSSRLDAHQKTLVELDQDVKKVNELITNSQSEISRRTILIERKQGLINFLNKQLERMVSELGGEEVGPLELEIKRLSKLIDEHDGKAVQAQVTWLRLQQEMVKVTQEQEEQLASLDASKKELHIMEQKKLRVGSKIEQEKKEQKEIEHHMKDLDNDLKKLNMLMNKNRCSSEELEQNNRVTENEFVRSLKASERETIKMQDKLNQLSEEKATLLNQLVEAEHQIMLWEKKIQLAKEMRSSVDSEIGQTEIRAMKGEIHRMKKYCRTTRDARRHVHEQHGTRAGTCTNNTGRAQARARTTRDARRHVHEQHGTRAGTCTNNTGRAQARARTTRDARRHVHEHRTHTARA

• Full Name: coiled-coil domain containing 40
• Calculated Molecular Weight: 1142 aa, 130 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC035251
• Gene Symbol: CCDC40
• Gene ID (NCBI): 55036
• RRID: AB_2879870
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4G0X9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.