CCDC53 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCDC53 Polyclonal antibody (24445-1-AP)

CCDC53 Polyclonal Antibody for IHC, ELISA

Cat No. 24445-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

CCDC53, CGI 116, WASH complex subunit CCDC53, WASHC3, x0009

• 

  IHC staining of human placenta using 24445-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 24445-1-AP (CCDC53 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 24445-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 24445-1-AP (CCDC53 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 24445-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 24445-1-AP (CCDC53 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 24445-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 24445-1-AP (CCDC53 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24445-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 24445-1-AP (CCDC53 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24445-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 24445-1-AP (CCDC53 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCDC53 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human placenta tissue, human breast cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24445-1-AP targets CCDC53 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19831

  Product name: Recombinant human CCDC53 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC010889

  Sequence: MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQSSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD

• Full Name: coiled-coil domain containing 53
• Calculated Molecular Weight: 194 aa, 21 kDa
• GenBank Accession Number: BC010889
• Gene Symbol: CCDC53
• Gene ID (NCBI): 51019
• RRID: AB_2879551
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3C0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CCDC53 Polyclonal antibody (Cat# 24445-1-AP) has 6 total citations published in Nature, Autophagy, Nature Communications, International Journal of Molecular Sciences, Frontiers in Cardiovascular Medicine, and EMBO Reports. Associated research fields include protein interactome architecture, endosomal trafficking and autophagy regulation, viral entry mechanisms (SARS-CoV-2 and influenza A), amyloid precursor protein processing, and mitochondrial protein homeostasis in cardiomyocytes.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Architecture of the human interactome defines protein communities and disease networks.; Authors - Edward L Huttlin
human	WB	Autophagy; WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway.; Authors - Danqiong Liu
human	WB	Nat Commun; A genome-wide CRISPR screen identifies host factors that regulate SARS-CoV-2 entry.; Authors - Yunkai Zhu
human	WB	Int J Mol Sci; Genome-Wide CRISPR Screening Identifies Genetic Modulators of Amyloid Precursor Protein Processing.; Authors - You Li ; KO Validated
zebrafish	WB	Front Cardiovasc Med; WASHC3 knockout disrupts mitochondrial protein homeostasis and energy metabolism in cardiomyocytes.; Authors - Sujin Kim
human	WB,IF	EMBO Rep; TRIM62 facilitates influenza A virus entry by regulating WASH-dependent endosomal trafficking.; Authors - Kajal Gupta