CCDC60 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC60 Polyclonal antibody, PBS Only (28652-1-PBS)

• 

  WB analysis using 28652-1-AP (same clone as 28652-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 28652-1-AP (CCDC60 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28652-1-PBS in a different storage buffer formulation.

CCDC60 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28652-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

28652-1-PBS targets CCDC60 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28109

  Product name: Recombinant human CCDC60 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-238 aa of BC040553

  Sequence: MTKVPATKKLQSSPNSGAVRPFYASENLRQVPDKPMKSIKYMDKEIINLKKDLIRSRFLIQSVKIGRGYFAILREETAKKKKQQQLQKLKEEERNKFQPAEKISEIHYGDTLLSTYDDEKLKTLGARVTRRPFTPIHSCIISPSLTEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVITCWNPKDPGGSKSTIKKINKDKSMGQKWEHFITAPKTKEFKIPTMRVTNRKPSRRGST

• Full Name: coiled-coil domain containing 60
• Calculated Molecular Weight: 550 aa, 63 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC040553
• Gene Symbol: CCDC60
• Gene ID (NCBI): 160777
• RRID: AB_3086075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWA6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Coiled-coil domain containing 60 (CCDC60) is a member of the CCDC family, which participates in the progression of many types of cancer.