CCDC63 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC63 Polyclonal antibody, PBS Only (33600-1-PBS)

• 

  WB analysis using 33600-1-AP (same clone as 33600-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33600-1-AP (CCDC63 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33600-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 33600-1-AP (same clone as 33600-1-PBS)

  IP result of anti-CCDC63 (IP:33600-1-AP, 4ug; Detection:33600-1-AP 1:600) with mouse testis tissue lysate 1680 ug. This data was developed using the same antibody clone with 33600-1-PBS in a different storage buffer formulation.

CCDC63 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 33600-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

Coiled-Coil Domain Containing 63, Coiled-coil domain-containing protein 63

---

Product Information

33600-1-PBS targets CCDC63 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39252

  Product name: Recombinant human CCDC63 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_152591.2

  Sequence: MSVLKKNRRKDSDTPQEPSEKAKEQQAEAELRKLRQQFRKMVESRKSFKFRNQQKIASQYKEIKTLKTEQDEITLLLSLMKSSRNMNRSEKNYMELRLLLQTKEDYEALIKSLKVLLAELDEKILQMEKKIANQKQIFAKMQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQ

• Full Name: coiled-coil domain containing 63
• Calculated Molecular Weight: 66kDa，563aa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: NM_152591.2
• Gene Symbol: CCDC63
• Gene ID (NCBI): 160762
• RRID: AB_3743025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NA47
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC63 (Coiled-Coil Domain Containing 63) is a highly conserved centrosomal satellite protein whose main functions are closely related to cell mitosis and ciliogenesis. This protein directly interacts with PCM1, a key organizer of centrosomal satellites, through its coiled-coil domain and is recruited to the pericentriolar material. As an important component of centrosomal satellites, CCDC63 is involved in regulating the normal assembly of the centrosome, microtubule anchoring, and proper orientation of the spindle, thereby ensuring the fidelity of chromosome segregation and genomic stability. Therefore, CCDC63 is one of the core molecules that maintain the accuracy of cell division and the function of organelles.