CCDC64B Polyclonal antibody

• 

  WB analysis using 22770-1-AP

  MCF-7 lysates were subjected to SDS PAGE followed by western blot with 22770-1-AP (CCDC64B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 22770-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22770-1-AP (CCDC64B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 22770-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22770-1-AP (CCDC64B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CCDC64B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22770-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Bicaudal D related protein 2, BICD related protein 2, BICDR 2, BICDR2, CCDC64B

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22770-1-AP targets CCDC64B in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18720

  Product name: Recombinant human CCDC64B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 209-508 aa of BC128602

  Sequence: LQSRRQDLEAQIRGLREEVEKGEGRLQTTHEELLLLRRERREHSLELERARSEAGEALSALRRLRRRVSELEEESRLQDADVSAASLQSELAHSLDDGDQGQGADAPGDTPTTRSPKTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQSLREELQRQKELRAQEDPGEALHSALSDRDEAVNKALELSLQLNRVSLERDSLSRELLRAIRQKVALTQELEAWQDDMQVVIGQQLRSQRQKELSASASSSTPRRAAPRFSLRLGPGPAGGFLSNLFRRT

• Full Name: coiled-coil domain containing 64B
• Calculated Molecular Weight: 508 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC128602
• Gene Symbol: CCDC64B
• Gene ID (NCBI): 146439
• RRID: AB_2918078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1A5D9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC64B, also named as BICDL2 and BICDR2, belongs to BICD family. It was officially named by Schlager et al (2010) in a sequence homology search for new mammalian BICD-like proteins. At present, there is still little study on this protein, which may involve the vesicle transport along microtubule, and Golgi to secretory granule transport. BICDR2 has 2 isoforms with the molecular mass of 57 and 34 kDa (PMID:20360680, 20485297).