CCDC68 Polyclonal antibody

CCDC68 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26301-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

CCDC68, CTCL associated antigen se57 1, SE57 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, SH-SY5Y cells
Positive IHC detected inhuman testis tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 2 publications below

Product Information

26301-1-AP targets CCDC68 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23622

Product name: Recombinant human CCDC68 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-335 aa of BC029508

Sequence: MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK

Predict reactive species
Full Name coiled-coil domain containing 68
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC029508
Gene Symbol CCDC68
Gene ID (NCBI) 80323
RRIDAB_2880470
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H2F9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Coiled-coil domain containing 68 (CCDC68) demonstrates a tumor-suppressive role in pancreatic ductal adenocarcinoma. (PMID: 25381825)

Protocols

Product Specific Protocols
IHC protocol for CCDC68 antibody 26301-1-APDownload protocol
WB protocol for CCDC68 antibody 26301-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Elife

Super-resolution microscopy reveals coupling between mammalian centriole subdistal appendages and distal appendages.

Authors - Weng Man Chong
humanIF

Adv Sci (Weinh)

CCDC68 Maintains Mitotic Checkpoint Activation by Promoting CDC20 Integration into the MCC

Authors - Qi Li
Loading...
||
New chat Able
正在加载,请稍候...