CCDC68 Polyclonal antibody

• 

  WB analysis of A431 using 26301-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 26301-1-AP (CCDC68 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 26301-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 26301-1-AP (CCDC68 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 26301-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26301-1-AP (CCDC68 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 26301-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26301-1-AP (CCDC68 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human colon using 26301-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26301-1-AP (CCDC68 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 26301-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26301-1-AP (CCDC68 Antibody) at dilution of 1:200 (under 40x lens).

CCDC68 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26301-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

CCDC68, CTCL associated antigen se57 1, SE57 1

---

Tested Applications

• Positive WB detected in: A431 cells, SH-SY5Y cells
• Positive IHC detected in: human testis tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 2 publications below

Product Information

26301-1-AP targets CCDC68 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23622

  Product name: Recombinant human CCDC68 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-335 aa of BC029508

  Sequence: MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK

• Full Name: coiled-coil domain containing 68
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC029508
• Gene Symbol: CCDC68
• Gene ID (NCBI): 80323
• RRID: AB_2880470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2F9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Coiled-coil domain containing 68 (CCDC68) demonstrates a tumor-suppressive role in pancreatic ductal adenocarcinoma. (PMID: 25381825)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Elife; Super-resolution microscopy reveals coupling between mammalian centriole subdistal appendages and distal appendages.; Authors - Weng Man Chong
human	IF	Adv Sci (Weinh); CCDC68 Maintains Mitotic Checkpoint Activation by Promoting CDC20 Integration into the MCC; Authors - Qi Li